McDonnell Genome Institute

Washington University

CircRNA

chr10|67180316|67539669|-|CTNNA3|ENST00000433211.6

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

2

Peptide

QALQDLLSEYMNNVK

Amino Acids from 5' Exons

NLIVLNPLTVTEEEIRPSLEKRLEAIISGAALLADSSCTRDLHRERIIAECNAIRQALQDLLSEYMNN,ILSIHSQLRRKYDHHRNALKPLSVGLLCWRILHVRGTYTESGLSQNATPFARLFRICFQSTT,FNCPESTHSNGGNTTITRETPSHYQWGCSAGGFFMYEGLTPRADYRRMQRHSPGSSGSAFRVHEQ

Amino Acids from 3' Exons

VKLKYQLRDLQMTPVFSQKGRLWFKLPVPCWLRRDSLSLRTLMSCASCNMCQ,SSESISEIYRPLFSPKKGGCGSSCPCLAGCGDETPYPCGHDCHVPLATCVS,EALKVSAERFTDDPCFLPKREAVVQAARALLAAVTRLLILADMIDVMCLLQHVSA