McDonnell Genome Institute

Washington University

CircRNA

chr10|63206594|63219983|-|JMJD1C|ENST00000399262.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.976

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

1

Peptide

LQSNSNR

Amino Acids from 5' Exons

RIRKKSFYGTITVCCIHISQKPGSKVTDWKRLSLTAFCGSSIKSVTEATPGDWREVKQIQRGTPSNSSRKYCCSLYNNQGTGERELFQSGIIIFQSKPYHQTRYGCRTLSIRSLNEALSASEFTPKLFHYIVCGQTTKIIPIQRSFKYLRTECPCSGSSSSNSDFIYNISFKASTFDTPTRKRFSRQDTRTSSTSDCISLSNNLQKLESYPFDSFFYKYTPQYACITSTSISPTNPSQPGKKGRQLSFPSNFNSGDASKCWWSSRITEASNSNTRTKRLPGKFEFFRTEFDGDVETPQQRENMACGEKQRKVTGCYGICHCASIFYKNYASNAVSFRSCKIFSWGTNRLPQTSRSRRNWKNHFAKCEFRQCSHKIKKLSGCLTGQCSQFSHVCCKYDVYQNGCNHICCRYYQCFQLGWFRSNFLFIKYHFGLYIIRMCIFKKCQSASGSKTRMQGQHHSTSYISQDRKCCSTQFWVLRHNFYPFKKAQGSIGCSSVKCQDTCYKKSDTFSLPSSGHCNLYNQSKLCRKWASFPDKSTKLPYTEKGLAHQTLRRRKYNGKFREFCIRNYAMFCQLNSLYIYTKCRDHSICKRSQQEKSQKNLIWLKWRLRKKQVRAKDKTTANLQKEAKFAKEKRNRRRFETQWSSQQECQRKKTEVAKQQ,ELERKAFMEPLRSVASTSAKNDLDLNRSQTGKDCHLHRHFVDPVLNQLQRPPQETGERLNKYKEEHRRILQESIDVAPFTTKIKGLEGERENYSRVASSSSSPKSHIIKQDMDVERSVSDLYKMKHSVPQSLPQSNYFTTLSNSVVNEPPRSYPSKEVSNIYGDKQSNALAAAAANPQTLTSFITSLSKPPPLIKHQPESEGLVGKIPEHLPHQIASHSVTTFRNDCRSPTHLTVSSTNTLRSMPALHRAPVFHPPIHHSLERKEGSYSSLSPPTLTPVMPVNAGGKVQESQKPPTLIPEPKDSQANFKSSSEQSLTEMWRPNNNLSKEKTEWHVEKSSGKLQAAMASVIVRPSSSTKTDSMPAMQLASKDRVSERSSAGAHKTDCLKLAEAGETGRIILPNVNSDSVHTKSEKNFQAVSQGSVPSSVMSAVNTMCNTKTDVITSAADTTSVSSWGGSEVISSLSNTILASTSSECVSSKSVSQPVAQKQECKVSTTAPVTLASSKTGSVVQPSSGFSGTTDFIHLKKHKAALAAAQYKSSNASETEPNAIKNQTLSASLPLDSTVICSTINKANSVGNGQASQTSQPNYHTKLKKAWLTRHSEEDKNTNKMENSGNSVSEIIKPCSVNLIASTSSDIQNSVDSKIIVDKYVKDDKVNRRKAKRTYESGSESGDSDESESKSEQRTKRQPKPTYKKKQNDLQKRKGEIEEDLKPNGVLSRSAKERSKLKLQSNSN,NKEKLLWNHYGLLHPHQPKMTWIIGHRLEKIVTYIGILWIQYISYRGHPRRLERGTNTKRNTVEFFKKVLMLLPLQLKSRDLRVRERIIPEWHHHLPVLKAISSNKIWMNAQYQIFIKSTQCLRVYPKVTISLHCLIVWSMNHQDHTHPKKFQIFTVINRVMPLQRQQLILKLLHLHLFQSLHLLNTNQKVKVARYQNIFHIRLHLTQQPSEMIVGVLPIQFLLQIHSAVCLHYIEHQYFTHQSITAWKERKAAIVVFPLQLLRCQMLVVKFKNHRSLQLYPNQKTPRQILRVLQNRVRRCGDLIITSAKRKLNGMWRKAAESYRLLWHLSLCVHLLVQKLIVCQQCSLLKIVLVKDLQLGHIKQIASNQKPEKLEESFCQMIQTVFTQNLKKTFRLSHRAVFPVQSCLLIRCVIPKRMSHLLPILPVFPAGVVQKFPLYQIPFWPLHHQNVYLQKVSVSQWLKNKNARSAPQHQLHPVVRQEVLFNPVLGSQAQLILSIKSTRQHWLQLSIKVVMPVRLNLMLKIRHFQPPFLWIALSVVQLTKQTLEMGKLPRQVNQTTILNKRPGSPDTQKKIKILIKWKIQGILYQKLLSHVLSTPLHLVIYKIVIVRSLINMKMIKSTGEKPKELMNLALKVETQMKVKASQSKGLKDNLSQLTKRSKMICKREKVKKKINPMEFSAGVPKKEVNSCKATVI

Amino Acids from 3' Exons

DDIDSLNPVLRDNPQLHEEVKVWVKEQKVQEIFMQ,TTTATQFSGTTRSFMRKKSGRNKRFRRFLCK,RHRQPKPSSQGQPAASGSESLGKGTKGSGDFYA