McDonnell Genome Institute

Washington University

CircRNA

chr10|60166823|60186912|-|ANK3|ENST00000280772.6

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9898

22

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

FLICLMMK

Amino Acids from 5' Exons

TVTEKHKMNVPETMNEVLDMSDDE,LSQRSTKMFQKRMKFLICLMMK,CHREAQNECSRNDESSYV

Amino Acids from 3' Exons

NGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNK,MVIRHCTSLPKRTRWTRQLCWNMVLMPTQLPGKELLPSISQLRKGTWTWCRCSSVEMRMTAI,WLYATAHRCQKEPDGHSDNSAGIWCCQRSYPARNCFRPSRSSGRARGHGVAAPRKCECEPEQ