McDonnell Genome Institute

Washington University

CircRNA

chr10|60042671|60060006|-|ANK3|ENST00000616444.4

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

33

Peptide

LSDGLVPSQGNIEHSADGPPVVTAEDASLEDSK

Amino Acids from 5' Exons

QGEGFKVKTKKEIRHVEKKSHSQRTVSQ,REKVLRKRRKKSGMWKRRATRNSERSVK,GRRFGENEERNPACGKEEPLVTANGQS

Amino Acids from 3' Exons

VILPFKWNWKPPQGCTTHHLPLSSKMIILVISLANLPLEPLVDVMGCLPRGTSIPQMDLQSLQKTLPKTANWKTQCLQKCLKQWMMRASWRMYVVSILNTLEIWLGPQKMLNQQSLENEALSSRRKENLVLMRRWKRNSNLYLRTFNLKKESLRRQKKKYRLFLSVFSKQNWKCLQLQVGRMRHQVETSPALKLEELVGYIDWMT,LSFPSSGTGNPHRVALHTTYPFPARLFYLHRISPNPTEWASAFPGEHRAFRRWTSSRNCRRRFLRRQQTGRLSAFNRNASSGCREPVGECMSEVSSIPWKFGWVPKRCTSRAKTRSKLAAGERKIWSGDDGRETQISIGHSTRRSRVGDDRRKSTGYSACSASRTGNVFNYRLAEDIKWKPRVLRSSSKSNWWVTRSTGQ,YPSLQVELETPTGLHYTPPTPFQQDDYFSDISSIESPLRTPSRLSDGLVPSQGNIEHSADGPPVVTAEDASLEDSKLEDSVPLTEMPEAVDVDESQLENVCLSEYPQYLGNLAGSPKDVKPAEPRKLGVSSEQQEKGKSGPDEEMMEEKLKSLFEDIQLEEGVESEEMTEEKVQAILKRVQQAELEMSSITGWQNETSSGNLESCAQARRVTGGLLDRLDD