McDonnell Genome Institute

Washington University

CircRNA

chr10|5785141|5786050|-|GDI2|ENST00000380181.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9384

21

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

8

Peptide

DLQGLMGLFEKR

Amino Acids from 5' Exons

LLRSTVLNHNTLQIFGKIWQKPIPLSTLWPWRTAPRICK,YLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFA,TINRVMKPLIELNFTVNLWQDMAKAHTFIHSMALENCPKDLQ

Amino Acids from 3' Exons

AWDCLKNVASGNSCMLPTSMKKIQELLKALILRRPQCEMCIRNLIWVKTLILLVMLLHFTELM,PNGIVKTSLQEIPSVCCQLRKRSKNFRHSEDHNARCVEIFGSRRYRFYWSCSCTLQN,LMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTD