McDonnell Genome Institute

Washington University

CircRNA

chr10|5768212|5768384|-|GDI2|ENST00000380181.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9334

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

SIESQIAR

Amino Acids from 5' Exons

IARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKS,LLAVSSSSVTPATKIGKKWARSELFASSATPSRTPMMPTPARSLFHRTKSIESQ,CSLAAHLPQLRKRSGRKSGPGDQSYLHPQPPHQEHQCQLLPDHYSTEPSQSKV

Amino Acids from 3' Exons

IARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKS,LLAVSSSSVTPATKIGKKWARSELFASSATPSRTPMMPTPARSLFHRTKSIESQ,CSLAAHLPQLRKRSGRKSGPGDQSYLHPQPPHQEHQCQLLPDHYSTEPSQSKV