McDonnell Genome Institute

Washington University

CircRNA

chr10|5766240|5768384|-|GDI2|ENST00000380181.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9764

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

DLGTESQIAR

Amino Acids from 5' Exons

ICHQPPGTKRLGNRKP,FVSISDLLVPKDLGTESQ,LLASVTSWYQKTWEQKA

Amino Acids from 3' Exons

IARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKS,LLAVSSSSVTPATKIGKKWARSELFASSATPSRTPMMPTPARSLFHRTKSIESQ,CSLAAHLPQLRKRSGRKSGPGDQSYLHPQPPHQEHQCQLLPDHYSTEPSQSKV