McDonnell Genome Institute

Washington University

CircRNA

chr10|5739617|5762646|+|FAM208B|ENST00000328090.9

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9441

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

2

Peptide

ILCEVHLTMNIIEELK

Amino Acids from 5' Exons

SKEKLLQSFNQKFQEVVKKMGLAIVFNQKIPQRLTMIFLKTPSSTMTPRPICPIHALLLLPHQYLRLEIFTVPLNCHKMMFCSLKKILCEVHLTMNIIEELKLKKVNYYLTHLLIGRVILDQTQLAKMKKAWFLVVRPLLKPSQHLLRKCNLQMQAKALLFLWNIHMPCSLQNIQRNIYRRERYALCFPGMGQKALKQQPQWGKSCHFGISPAFCFSKSLLTTPWSPRIDHRLPVKNLLALVCLAVMTPLRSLSNVKQNMHSVTANIPTTHWRKLEHYM,QRRNCFKASIRNFKRLSRRWDHKCSTRKYHSGSQSSKLHRQLLPGPKYVSRSSIKLCYFFHTSIGKSSLFLIATKCFALRKFFARYIPISRSNSKRITTPIFEEFWIRLNSPRRKLGSLSGPCSPVSTYGNARIFRCKPKLFCFCGTFICPAPYRTFKETSTGERDTKPSVSQEWDKKPSSNPSGESHAISASARPFASAKASRPRGEAQGSTTVCPCEKIFLLSYSALLRDHFQMNRICIQFRQQIYQQPTGENCSKSITW,KGETASKLQSEISRGCQEDGISINSVQPENTTAAHNDLPENSIVNYDSQALNMLADLALSSATSSTPVSEARNLHCSSELPQNDVLLSKENSLRGTSDHEYHRGVKTQKGELLPNPSSDRKSNSGSDLTVSQDEESLVPCSQAPAKAQSALTEEMLESSDASQSSSVSVEHSYALLLTEHSKKHLQEREILSPLFPRNGTKSPEAATPVGKVMPFRHQPGLLLQQKPPDDPVVKPKDRPPSARVKKSSCSRIVLSCDDSVKITFKCETEYAFSLDSKYTNNPLEKTVVRALH

Amino Acids from 3' Exons

TSLLSPEKSLKIVESLLQMITLKTKKQLHLGVAI,QAYYPQRSLKWNPCYRCKLYRKHRKNSSSIELL,KPTIPREVFENSGILVTDVNNFIENIEKIAAPFRSSY