McDonnell Genome Institute

Washington University

CircRNA

chr10|49857305|49934163|-|PARG|ENST00000402038.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9626

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

LDYISNLK

Amino Acids from 5' Exons

VDFANRFVGGGVTSAGLVQEEIRFLINPELIISRLFTEVLDHNECLIIT,WILQIVLLEVVPVQDLCKKKSAFSILSLFHGSSLRCWITMNVLSQ,GFCKSFCWRWCNQCRTCARRNPLFNQSVDYFTALHGAGSQMSNYH

Amino Acids from 3' Exons

FGRKQQYKNRIHDEFCTKRLLPTCRKIRKCFSAKSVTHKKYTVFEPASDCSNVVAKRETHGAAFGKTSNSNPGTRAVCHSVTSKSQHRRERQSTVSHNCKACKCKADYRRTGQRSQKPPEVQQVLRSWGRLCKLSARDRCGARESIVRCWLGCWYWAKKQQIDTRKLPRKFSSIEGKTRVTDGCGFKLSRLRSRGDKSRFTRRWFLPNSKTFKVPSKRRHIETVLYGRSITFPIRRRESHWNEFKCTTWKYFPECRMQKFATWKKGFNHRSFHETAQSRGQK,LDSKENNNTRIESMMSSVQKDNFYQHNVEKLENVSQLSLDKSPTEKSTQYLNQHQTAAMCKWQNEGKHTEQLLESEPQTVTLVPEQFSNANIDRSPQNDDHSDTDSEENRDNQQFLTTVKLANAKQTTEDEQAREAKSHQKCSKSCDPGEDCASCQQDEIDVVPESPLSDVGSEDVGTGPKNDNKLTRQESCLGNSPPFEKESEPESPMDVDNSKNSCQDSEADEETSPGFDEQEDGSSSQTANKPSRFQARDADIEFRKRYSTKGGEVRLHFQFEGGESRTGMNDLNAKLPGNISSLNVECRNSKQHGKKDSKITDHFMRLPKAEDR,WIVKKTTIQENPVLYKKITFTNIMKNKMFLSVLISHPLKKVHSITSIRLQQCVSGKMKGNTRSSFWKVNLKQPWYQSSLVMLTLIGHLKMMITVTQIVKRIETINSFSQLSLQMQSRLQKMNRPEKPKATRSAASLAILGKTVQVVSKMRMWCQRVHCQMLALRMLVLGQKMTTNLDKKVAEILLHLRRKVNPSHRWMWIILKIVVKTQKQMRRQVQVLMNKKMVVPPKQQINLQGSKQETLTLNLGNGTLLRAVKLDYISNLKEERVALEMIMLNYLEIFLAMNAEILSNMEKRILKSQIISDCPKQRTE