McDonnell Genome Institute

Washington University

CircRNA

chr10|484780|486530|-|DIP2C|ENST00000423550.2

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

LQHSEGAPR

Amino Acids from 5' Exons

QRMELPWFGVDCSTVKERRGEHSALPTSGCATSEKLRLGSGWPAPQGTGLCFTFVS,SEWSCRGSVTAAQRSAEENIPLCPHRGVRRPRSCGSGAGGQHRREPASVLLSF,ANGAAVVRCRLQHSEGAPRRTFRSAHIGVCDVREAAARERVASTAGNRPLFYFRF

Amino Acids from 3' Exons

VTSHKKDMKRRGQSLEPTFRSLR,HHTKRIKEEVKVNWSLPSAAS,DITQKGYEKKRSKLIGAYLPQPP