McDonnell Genome Institute

Washington University

CircRNA

chr10|42816598|42823784|+|BMS1|ENST00000374518.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9782

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

SSTVTLK

Amino Acids from 5' Exons

RSSTVTLKTWKQGTCTRENQAPIL,GALRLRLGNRGRAQGKIRPQYS,ELYGDFEDLETGDVHKGKSGPNTQ

Amino Acids from 3' Exons

ILSSCELGILFPSQRSITQHLCNQWVRKTPGQECGPRANSGSPMASDRRTRTLCI,YCLHANLVSCFHPSVLPSNIFVETSGERHLVRNADHGPTQARPWRQTKGEQGLSV,IVFMRTWYPVSIPAFYNPVTSLLKPVGEKDTWSGMRTTGQLRLAHGVRLKANKDSLYK