McDonnell Genome Institute

Washington University

CircRNA

chr10|422823|440996|-|DIP2C|ENST00000280886.10

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9988

21

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

GCPQAGGR

Amino Acids from 5' Exons

IPLLAQKMKAQCRGTPRAPPPPARAASIWSTGSARPSTAPPRPPPPRPLRRAGAAGLPTGWRTSWLRPT,YLFWLRRRLSAGGLPGHPHLQPGQHQYGALDQPGHPRLHHVHHLLVLYAERGQRGCPQAGGRHGSDPH,TSSGSEDEGSVQGDSQGTPTSSQGSINMEHWISQAIHGSTTSTTSSSSTQSGGSGAAHRLADVMAQTHI

Amino Acids from 3' Exons

TSTRKLSRRLWPNTKSGRWQCLCLPNAGPWSCRPRWTPTPLQ,RPHGSCPGGSGQTQRAEDGSAYAFQTQVPGRADLDGRLHPS,VHTEAVQAALAKHKERKMAVPMPSKRRSLVVQTSMDAYTPP