McDonnell Genome Institute

Washington University

CircRNA

chr10|35035171|35060968|-|CUL2|ENST00000374746.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.935

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

ATSNLTQENR

Amino Acids from 5' Exons

TWQICTSYSVLCPLVYLIFRSCKTTSMMRAFEQPATLLRK,HGKYVRLTPCCVHWFTSYDSGAAKPHPGPSSNQQPYSGK,MANMYVLLRAVSTGLPHMIQELQNHIHDEGLRATSNLTQEN

Amino Acids from 3' Exons

RVLESEEQVLVMYHRYWEEYSKGADYMDCLY,EFWSQKNKYLLCIIGTGKNTARVQTIWTAYI,SFGVRRTSTCYVSVLGRIQQGCRLYGLLI