McDonnell Genome Institute

Washington University

CircRNA

chr10|35011847|35033273|-|CUL2|ENST00000374748.5

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9621

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

15

Peptide

VLRHNALIQEMPTLFVESVLEVHGK

Amino Acids from 5' Exons

EMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQE,KWSRLEVQLMRTGKCISKLLFVSKHEKCFGTMPLFK,NGADKCSGPENVSPSCYSSYHESTKSASAQCPYSR

Amino Acids from 3' Exons

MPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDK,CQHYLWSQFWKCMVNLFSLSTLFMVISILVRWI,ANTICGVSFGSAWICSAYQHCFEWSAFYECVG