McDonnell Genome Institute

Washington University

CircRNA

chr10|33254027|33270856|-|NRP1|ENST00000265371.8

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9914

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

MGGLPER

Amino Acids from 5' Exons

ISNVWKLWAWNQEKFILTRSQLLPSIAPTGLQSAPATTLRMGGLPERIPTESGY,FQMYGSSGHGIRRNSFPDHSFFPVHQLVCRALPPELPEWVDSRRGFLPRVDT,FKCMEALGMESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQ

Amino Acids from 3' Exons

VLRGSLRWRKKWTFGKVLWKDSPSSCCVFRAISFYQICLLRNTWCRIFHTLNFQE,YDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKR,MTTWKSSMEKMKMDILGESSVERPLLLLCLQGHFFLSNLSLTTKHMVQDFPYVMKFSRE