McDonnell Genome Institute

Washington University

CircRNA

chr10|32928093|32930044|-|ITGB1|ENST00000302278.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9467

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

12

Peptide

LTFLQEGMPTSAR

Amino Acids from 5' Exons

GSHRHLHNSRELKTIPLTSTTLWTCLTQKTIWRMKVLEQIMKGGLLRTSEL,GATDIYIKIQESRLSHPLLPYGPVLLNERRFGECKKSWNRSDENEEDYFGLQN,EPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRI

Amino Acids from 3' Exons

TFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRS,HFYRKECLLLHDVMIKPKRRVALQMTKIPEAPKIRKIKMPTVAKEQQRSSSQRILLRSNHSSWFCDDQ,IFTGRNAYFCTMFRSLKKEGLPSRHRKSQRLQRYKEKKCNQPQRNSREAQARGYYSDPTTAVGFAIKI