McDonnell Genome Institute

Washington University

CircRNA

chr10|32925870|32932600|-|ITGB1|ENST00000302278.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.997

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

22

5

Peptide

ISGNLDSPEGGFDAIMQVAVCGMKIDV

Amino Acids from 5' Exons

DLAHLWKRLCLTLAQHQLSSGTLAQVNRTAPAHLATKMCSVLLIKEKYLMNLLENSAYLEIWILQKVVSMPSCKLQFV,IWLICGKDCDALHHNTSAQEPLHKTELHQPILQKCAQSYRRSITCWKTAHIWKFGFSRRWFRCHHASCSLW,FGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCG

Amino Acids from 3' Exons

MKIDVKQMPNHVENVYKQGQIVGGAQI,KMFKSKCQIMWRMYTSRAKLWVVHKF,ENRCLKANAKSCGECIQAGPNCGWCTNS