McDonnell Genome Institute

Washington University

CircRNA

chr10|32908367|32912124|-|ITGB1|ENST00000302278.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9563

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

SAVTMESASADSVFVGR

Amino Acids from 5' Exons

SVPLVQTSFQLLVWLLELFLLALHYCYGSFFMTEGSLLNLKRRKMPNGT,VSHWSRHHSNCSWCGCWNCSYWPCITADMEAFNDNSQKGVCIKGENECQMGH,CPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDT

Amino Acids from 3' Exons

VQRACWTLMQHRSQRHGCLLQERKQFRNLQQWRVRLRTVCLEEGYKNLFWQILRVFQLIQWLNLW,CNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICG,AMKGVLVDIVNAAQMKLTVKTWMLTAGKKTVQKSAVTMESASADSVFVGRGIIQMKFILANSASVIISTVIDPMAFVE