McDonnell Genome Institute

Washington University

CircRNA

chr10|31812706|31861658|-|ARHGAP12|ENST00000311380.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9676

176

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

LFVKKVILK

Amino Acids from 5' Exons

PLKYLAILQNRKKPRKTRSFLHDAPLCKLFVKKVILK,LSIHRFFRTEKNQEKLKEVSYTTPHFASCSKRLY,FKVSSIDSSEQKKTKKNLKKFLTRRPTLQAVREKGYIK

Amino Acids from 3' Exons

ATTPPNQGRPDSPVYANLQELKISQSALPPLPGSPAIQINGEWETHKDSSGRCYYYNRGTQERTWKPPRWTRDASISKGDFQNPGDQE,QPHLQIKEGQILLSMLTFKNKYPSLLFPHFLGARQFRLMENGKLIKTAQGVAITITEGHRKELGNLLVGLGMQASAKEISKIQGIK,NHTSKSRKARFSCLCPSRTENIPVCSSPTSWEPGNSDWRMGNSRQLRALLLLQRDTGKNLETSSLDSGCKHQQRRFPKSRGSR