McDonnell Genome Institute

Washington University

CircRNA

chr10|3143388|3148291|-|PITRM1|ENST00000380989.6

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9293

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

TVPYTDPDHAR

Amino Acids from 5' Exons

EPTFKPWQMKTHFLMPFPVNYVGECIRTVPYTDPDHA,NPPSSPGRRLTSCPSRITWVNASELSPTRTQIMP,THLQALADEDSLPDALPGELRGMHPNCPLHGPRSCQ

Amino Acids from 3' Exons

AGLRPSLPGAGSADRIEDRRDECFSPRAPRRLTHGHLRAG,LGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQV,WAAAFLTTGSRLSRNRPEGVLLPTCSPTTHTWTPTSR