McDonnell Genome Institute

Washington University

CircRNA

chr10|3103778|3109480|+|PFKP|ENST00000381075.6

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9521

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

ADGQIDK

Amino Acids from 5' Exons

ARSIRRPCRSTPTSTWWAWWAPSTMISAAPTPSARTPPCTGSSRSSTPSPRPR,PDRGGRAEVRLPQRGGHGGLHRQFLRHRHDHRHGLRPAQDHRGRRRHHDHGPE,QIDKEAVQKYAYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQ

Amino Acids from 3' Exons

ASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMECVQM,PAAWEWRQSSPCRPPRTPQLASCHTGTTPCACRWSACR,QPHGSGGSHRLARGHPGHPSLRRVTEREPRRAPAADGVRAD