McDonnell Genome Institute

Washington University

CircRNA

chr10|30322390|30337027|-|MTPAP|ENST00000263063.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9309

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

RSAEHSLEGVPANR

Amino Acids from 5' Exons

DCLDKFRTPLYIWCPRLKSESLGVQCTVLGSSTFTNKYSWCMDYKFLPYNDGHLFSPEKITPYSSNTRFLKNPS,IALTSSELLYIYGALDSRVRALVFSVRCWARAHSLTSSIPGAWITNFSLTMMVIFFLQRRSPPILPTLDSLKTLA,LPQVPNSFIYMVPTQEEPWCSVYGAGLEHIHQVVFLVHGLQISPLQWSSFFSREDHPLFFQHIPKPQ

Amino Acids from 3' Exons

IDDQLNTLLKEFQLTEENTKLRYLTCSLIEDMAAAYFPDCIVRPFGSSVNTFGKLGCDLDMFLDLDETRNLSAHK,TISTLSRSSSQRRTLSSDISPVLLLKTWPPRIFQTASDPLAPQSTLLGSDVIWTCFWIMKPETSALT,RRSAEHSLEGVPANRGEHAPISHLFSYRHGRRVFSRLHSQTLWLLSQHFWEVRMFGHVFGSRNQKPQRSQ