McDonnell Genome Institute

Washington University

CircRNA

chr10|29550596|29563292|-|SVIL|ENST00000355867.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9666

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

EQLANHER

Amino Acids from 5' Exons

ADQMKRRKLLILLKSKLDPNTAQKPPVSTVTHPMVRVPWTPTVWSPKPKELQGTKQKEGDSWQRSMGLWIPRPTPSIYPAIPSPGRSLMLSRSGEEKVTNRKSQAEMLVLCTPGPRRWGSGPVPVNPRTMPSMWVTALPTRRCCTKTKDEVKSVPPGRPMTCPQQPRVPRPSLSLGETPPSLKCHGPPSTPTAPPCSRQPPGAPPLVTHSYPLRPDP,PIKRGGNFFFSRKANSIQILHRNLRCPRLTLWFGYHGHPQSGVQSRKNCKVQSRKKATAGREVWADSGSRGRLRVFIPLYQVQEGACCREAGRKKQTGRVKQRCFSVPRDRDDGAQDLCRIQGLCPPCGRLFRPGGAAEHRKPKTRSRAECHPAGPPVPSSREFLDLLFLWARLLLHSATVPQARPQLLPAAGSLPEPLLWPTAIPGPTQ,RSNEEEETSDSSLEKQTRSKYCTETSGVHGDSPYGSGTMDTHSLESKAERIARYKAERRRQLAEKYGLTLDPEADSEYLSRYTKSRKEPDAVEKRGGKSDKQEESSRDASSLYPGTETMGLRTCAGESKDYALHVGDGSSDPEVLLNIENQRRGQELSATRQAHDLSPAAESSSTFSFSGRDSSFTEVPRSPKHAHSSSLQQAASRSPSFGDPQLSPEARP

Amino Acids from 3' Exons

LSEGVLTRRRTARPRKRNRCSAFSCTS,FQKEFSLEDKEQLANHERGIDAQLLVALPK,FRRSSHSKIKNSSLTTKEESMLSFLHFLK