McDonnell Genome Institute

Washington University

CircRNA

chr10|29462276|29463635|-|SVIL|ENST00000355867.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9641

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

SLVPPASAGPPTGR

Amino Acids from 5' Exons

EKISRNQPPSLTLSTLVWSPHSPICFPAGSTERTSLRSQR,KKSQETSPQVLPYPRWSGAPDIHQYVSQLGAQRGHRDHRD,KNLKKPAPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEM

Amino Acids from 3' Exons

HFSLLTITTRCTSGKAGGPSRTRSLVPPASAGPPTGRVRWRLCSSTAK,TFPCQSPRGVPLARLVAHREQDHWFRPHPLGLRPEECDGDCAPVLQ,LFLVDNHHEVYLWQGWWPIENKITGSARIRWASDRKSAMETVLQYCK