McDonnell Genome Institute

Washington University

CircRNA

chr10|27208245|27223452|-|ACBD5|ENST00000375888.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9267

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

10

Peptide

LETLTALQIIETMPMTEK

Amino Acids from 5' Exons

DIGCNTAKEPRAGRWEVEVMGSAGAPTEGPEAASMSRSPSCDCRRTCRMSFRDCRNWKRLLC,TDATLERRNQGPAGGKWRWGALGLRQRVPRQPQADRPRADETAGGHAECPSETAETGNADCFA,HRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMRLQEDMQNVLQRLQKLETLTALQ

Amino Acids from 3' Exons

IIETMPMTEKVEELLRVIGPFYEIVEDKKSGRSSDITS,LLKLCQLRKLKNCCVSVHFMKLSRTKRVAGVLIPQ,YNYANDESRIAACHRSILNCRGQKEWQEFYNL