McDonnell Genome Institute

Washington University

CircRNA

chr10|26751597|26777241|-|ABI1|ENST00000346832.9

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9285

34

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

3

Peptide

MIHMQMGILLGPPR

Amino Acids from 5' Exons

LLIVQLHRHHLHQMTFPCLMTLHLPHHHHQWIMKMRRLQFSIMIHMQMGILLGPPRIILRK,CSNSTATTSTRHSHVLSTSPTTTTSGLRGGCSSSVSICRWGSCLGPQELYE,ADSPTPPPPPPPDDIPMFDDSPPPPPPPPVDYEDEEAAVVQYNDPYADGDPAWAPKNYIEK

Amino Acids from 3' Exons

TVDIHKEKVARREIGILTTNKNTSRTHKIIAPANMERPVRYIRKPIDYTVLDDVGHGVK,LWIFIRRKWHEERLVFQQIRIHQELTKHLRIWSALGIFGNLSITQFWMMWAMVS,CGYSGESGTKRDWYFDNKEYIKNSQNNSTCEYGAPCKVYSETYRLHSSGCGPWCQ