McDonnell Genome Institute

Washington University

CircRNA

chr10|26511746|26513660|+|APBB1IP|ENST00000376236.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9136

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

NPQLVVK

Amino Acids from 5' Exons

LVVKVHMNDNSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQI,SSSRCTMITAQSHWWMSGSWPEMFWTTFSRKLIVTAMTGVFMKSTRNYKL,RRQGAHEQHKVTDGGAAAGPRCSGQPFRENSLLQCRLVSLNLPGTTN

Amino Acids from 3' Exons

RGFLKTMKMLLKSYQTGQETQKIKYYFWRKRRNMLYLKTP,EVFRPKCCSLIRLDKRHRKNTIFGERGEICCIKPP,RFFEDHENVVEVLSDWTRDTENKILFLEKEEKYAVFKNPQ