McDonnell Genome Institute

Washington University

CircRNA

chr10|246765|249088|+|ZMYND11|ENST00000309776.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9279

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

QWGLDSF

Amino Acids from 5' Exons

GLDSFKHSRYHSQHSSAAREAQYGLEKGLAGAASAFPTRREILEIEGPRGRGRIQYLLHQA,AWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQ,PGFLLKTFKISQSTFIGCTSAVWVGKRPVMSWSCISVSYEKGDFGNLRMRTEVRKRQNPVSPPPVMS

Amino Acids from 3' Exons

LRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQTKKKQW,CVLKWKKKRDKLIKLPTCRVRWTENVSKRKSVRKNLKKSRSWQHSTSNFLRPRRSS,AFNGRRKETSCKSCSQHAGDGQKMASKGKVGRICRRNQEAGNTAQATDFSDQEEAV