McDonnell Genome Institute

Washington University

CircRNA

chr10|24666984|24670397|-|ARHGAP21|ENST00000320481.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9604

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

METEEVSK

Amino Acids from 5' Exons

DEENGNRG,MKKMETEE,RKWKQR

Amino Acids from 3' Exons

VSKNKDGKEQSETVSLSEDETFSWPGPKTVTLKRTSQGFGFTLRHFIVYPPESAIQFSYK,SQKIKMEKNKVKLYHCLKMKHSPGQVPKQLRKEHLKALVLHDILLFIPQSLQFNFHI,LKKRWKRTKNCITVRNILLARSQNSYVEKNISRLWFYIKTFYCLSPRVCNSIFI