McDonnell Genome Institute

Washington University

CircRNA

chr10|24531829|24536893|+|KIAA1217|ENST00000307544.10

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9465

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

GQAMWSTPAERR

Amino Acids from 5' Exons

KILQIRNRTWKSWGESRPLLLRHLLVEATCQDRDSPPRGQAMWSTPAERRTSPL,RFSKFGTGLGKAGGKVAPSSSATSSSKLPARIGTHHHEVRRCGLHRQKGEHHR,DSPNSEQDLEKLGGKSPPPPPPPPRRSYLPGSGLTTTRSGDVVYTGRKENITAK

Amino Acids from 3' Exons

AFQKCSFMDVNSNSHAEPSRADSHVKDTRSGATVPPKEKK,HSRSVPLWMIQTVMLSHPGLTVTLKTLGRAPQCHPRRR,IPEVFLYGCKFKQSCAIPGQSRRHVGRHSATQGEE