McDonnell Genome Institute

Washington University

CircRNA

chr10|209888|249088|+|ZMYND11|ENST00000309776.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9553

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

KQWVYVSSPR

Amino Acids from 5' Exons

VYVSSPRYAPRDHPSAELSCERWSYCRNSNSGLQRFKSWYTRRILVARRD,YMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEI,ICLESTVCTLKRPPVSALKMVLLSKLQWAAKVQKLVLNKKDIGCQEMR

Amino Acids from 3' Exons

LRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQTKKKQW,CVLKWKKKRDKLIKLPTCRVRWTENVSKRKSVRKNLKKSRSWQHSTSNFLRPRRSS,AFNGRRKETSCKSCSQHAGDGQKMASKGKVGRICRRNQEAGNTAQATDFSDQEEAV