McDonnell Genome Institute

Washington University

CircRNA

chr10|20840738|20852649|-|NEBL|ENST00000377122.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9968

28

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

1

Peptide

RASEMASER

Amino Acids from 5' Exons

KEYKKDLENEIKGKGMELNSEVLDIQRAKRASEMASE,KNIKKIWKMRKGKEWNLIQKFLISKEQSEPLKWQV,RIKRFGKDKRERNGTFRSSYPKSKASLNGK

Amino Acids from 3' Exons

REYKKLFEENKGMYHFDADAVEHLHHKGNAVLQSQ,ENIKSSLRKTKECIILMQMLWNICTIKAMPSSKV,RIKALGKQRNVSFCRCCGTSAPRQCRPPKS