McDonnell Genome Institute

Washington University

CircRNA

chr10|17833674|17856352|+|MRC1|ENST00000569591.2

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9654

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

LQEIEGSESLWNK

Amino Acids from 5' Exons

LRAVKAYGIKTRPAFPTRTPNPLRGTRRGKAANNRTLSSASQRFMSKHTQ,GQKLMERPADQRFLPDKLQIRFNVAPGEEKLPTTERAPEHHRDSANIPD,EGSESLWNKDPLTSVSYQINSKSALTWHQARKSCQQQNAELLSITEIHEQTYLT

Amino Acids from 3' Exons

DGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRK,MGTGQIGAVSGLLATSARNHEAKVQKWKSKKAAG,WVLGRSGLVASWLHLQDEITKPRSRNSGSRKRLQE