McDonnell Genome Institute

Washington University

CircRNA

chr10|17233586|17236379|+|VIM|ENST00000469543.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.944

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

8

Peptide

TVETRDGQDVDNASLAR

Amino Acids from 5' Exons

DVDNASLARLDLERKVESLQEEIAFLKKLHEE,MLTMRLWHVLTLNAKWNLCKKRLPFRNSTK,CQCVSGTSPTQSGIFARRDCLFEETPRR

Amino Acids from 3' Exons

NESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRGTQTWMRELMVTICALCHWALSSVTFNLKVSLRLLSTFCRGGIIEREVTCKRVNQQQSWDLNPLCQSLHSLLFMLLWRKCLHILNVLTRPVMGKCFDKSLVYDLKQYVFLRDENKKCVNLFPVVEVICQQFYCFSSSVYRISLPLPNFSSLNLRGKHFISLEKRQLLVTTVFMSKHSFFLGYLKKCHIRENSIKHLFSNPSTLLHSMLVKCKLLFPSSCCKYYLILMLKSVRAWVSKQRLPNYLASSTLHNCLSPTNHNCFSKMVTWFFQEKTRFYSFLACLFIKLIWIHSLWLIPTQKGHFLRRLKLEMD,MSPWNARCVKWKRTLPLKLLTTKTLLAACRMRFRIRRKWLVTFVNTKTCSMLRWPLTLRLPPTGSCWKARRAGRELRLGCVNWPFVRPCATGLAVSHLIFRKFLGNCFPLFVEEEFELRESKLAEKGLINSRAGITHNSVKASTPNSCSCSCGENACSNIFMYQDQSWENVSETNLFMINSTFSYVTKTKSVLICSQWLKLFANNFTVSLHLFIGFLCLFQTFPPTGVSILFPFRKNVSCLPLCLCQSIHFFDIKNAIEKTLNIYNFRTQVHSCILCFKLNANSFFLLPAASTISSCSRVSGPGFPNRDYPKIIWRVVLYTIASPPQIIIVSVKWLLGFSKKKLVFTHFWPVCLFRNSGFTPSGYPLKKDTSDDGNRWT,VPGTPDANGRELCRSCLPRHYWPPAGDSEYEGGNGSSPSIPRPAQCDGPHDCHLQEAAGRRGEQVGNSDLDATNGDHLLGPVPLGSKQCHISLESFFEVTAFHFLRRNLNERVSDLLKKGSTAELGFEPITLSKPPLLTPVHAPVEKMLVVTYFKCTNKTSHGKMFLRQISSLFKTVRFLTRKQKVCFVPSGSYLPTILLFLFICLDFSASSKLFLPEPEGAFYFPLGKTSAACNHCVYVKAFIFFRISEKMPYKRKLYKTSIIFEPKYTLAFYALSMQTPFSFFLLQVLSHPDAQECQGLGFQTETTLKLFGEYFTQLPLPHKSLFQNGYLVFPRKNSFLLIFGLFVYLETNLDSLPLVDTHSKRTLLIKTVETRDGQ