McDonnell Genome Institute

Washington University

CircRNA

chr10|16948477|16990515|-|CUBN|ENST00000377833.8

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9195

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

22

20

Peptide

FVSDSSISAGGFHTTVTASVSGCGGELSGATGSFSSPGFPNR

Amino Acids from 5' Exons

AVTVAPTCPILSHPSAAPRDSSLILASVLGVSTPRSPHQCR,PLLWHRHAPSYHILQQRPDAEIRLFHQCWGFPHHGHRISV,RYCGTDMPHPITSFSSALTLRFVSDSSISAGGFHTTVTASVS

Amino Acids from 3' Exons

VVVESCLGPQAPSAAPGSPTGIHQTRSVSGTLGRTPGVAFSSPSMTSMWSIIQGATLMSW,LWWRAVWGHRLLQQPRVPQQVSTKQGVYLVHDGPREHSAHHPLRCGVSFKVQLCLG,CGGELSGATGSFSSPGFPNRYPPNKECIWYIRTDPGSSIQLTIHDFDVEYHSRCNFDVLE