top of page

McDonnell Genome Institute

Washington University

CircRNA

chr10|14852369|14867909|+|HSPA14|ENST00000378372.7

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9231

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

LEAYLQCALNSMSLMGR

Amino Acids from 5' Exons

QYFGVAWRNILISQRHGSQWNISGSFNKHHRWCTFHRNLSTVSSFVPK,NILVFKLGGTSLSLSVMEVNSGIYRVLSTNTDDNIGGAHFTETLAQYLASEFQ,IFWCLSLEEHPYLSASWKLTVEYIGFFQQTLMITSVVHISQKPHSILLSSK

Amino Acids from 3' Exons

GVDESGASRFTVLFPSGTPLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQ,VWTNQEPVDSQCCFHQGLLCQLEDNTHCKPLEAYLQCALNSMSLMGRTLPKRKPSLH,CGRIRSQIHSAVSIRDSFASSKTTHIASPWKHIFSVPTLVWEELCQRGNQVCT

bottom of page