McDonnell Genome Institute

Washington University

CircRNA

chr10|13656635|13666325|-|FRMD4A|ENST00000357447.6

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9976

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

2

Peptide

TGLSQLGQHAQPGGAR

Amino Acids from 5' Exons

VGGHQPHPTAQPRTALAPELQPGVPGQAPGLGKRHREPRLLHPADSQQRLRPHGRLLVVHQPLELGALLPGADERQLLHAGRGLAVQGAPEAEAAAAGGGRTGLSQLGQHAQPGGARGCGGRGGRGGRCVPAQPEPAQLAVPHQGVPAVHRGRRHARGGAQPGERPGGPLQRQGSVQDVQLLHGGRPVQGELARRRRRRGRHGPPDAVAIADPADSVAGPRGRPRQGRGPCRRLRRAAPVVPAFHRLAQGAQPPVAHQLHLLGQRLAVQHLLPEHLRGAQQGHQDAPDVQGHV,SVDISPTRLHSLALHFRHRSSSLESQGKLLGSENDTGSPDFYTPRTRSSNGSDPMDDCSSCTSHSSSEHYYPAQMNANYSTLAEDSPSKARQRQRQRQRAAGALGSASSGSMPNLAARGGAGGAGGAGGGVYLHSQSQPSSQYRIKEYPLYIEGGATPVVVRSLESDQEGHYSVKAQFKTSNSYTAGGLFKESWRGGGGDEGDTGRLTPSRSQILRTPSLGREGAHDKGAGRAAVSDELRQWYQRSTASHKEHSRLSHTSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQMCKATS,RWTSAPPDCTASHCTLGTGAPAWSPRASSWARKTTPGAPTSTPRGLVAATAQTPWTTARRAPATRARSTTTRRRTPTTPRWPRTRRPRRARGRGSGSGRRAHWAQPARAACPTWRRAGVRGARGARGAVCTCTARASPARSTASRSTRCTSRAAPRPWWCAAWRATRRATTASRLSSRRPTPTRRAACSRRAGAAAAATRATRAARRRDRRSCGLRRWAARAPTTRARAVPPSQTSCASGTSVPPPRTRSTAACRTPAPPPRTAARSTAPPPRAPSWRTAGSPGCPRCARPRQ

Amino Acids from 3' Exons

EAELERLEREFAIQSQITEAARRLASDPNVSKKLKKQRKTSYLNALKKLQEIENAINENRIKSGKKPTQRASLIID,KLSWNAWNESLPFSPRLRRPPAAPVTPTSAKNRNKGKPRIMHRNCRRLKMQSMRTASSLGRNPPRGLRST,SAGTPGTRVCHSVPDYGGRPPPSQPQRQQKTEETKENLVSECTEETAGDKCNQEPHQVWEETHPEGFADHR