McDonnell Genome Institute

Washington University

CircRNA

chr10|1363027|1363917|-|ADARB2|ENST00000381312.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9677

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

GGAGTQVLR

Amino Acids from 5' Exons

VPAARRRRTATWATWPRGHRPPGTGPGAARPARRGSGRWRRGMGATCANCSWSGRSCRGRWRPRTRWCSCTSGRACSTGQCRRRARCMPRSSRRWRTGSRSRAQAPPRRRPRCARRSWHSGPSCSSPTPARRTWPWAGARAPARTSPPTRPISPTRSSRSSSPRRRAPDSREAAPGTPRFCPRPTGDGGCCAARWTWWARPPPPPRPRASATPWCCTACAPGCATCVWQNRPSGARGASWPAWTAGRSRARGAARSWPGVRPRRPHCRSCSTSRCPATRPAGPGGRQCR,YQQRGGEGEPQRGQPGRAATALRGPGPGRRARREEEAAAGGGEWGPLVQTAAGLEEAVVVGGAQERAGAAARAEAGPAVPDSVADGPGACPGLRGSGGGERAHVRGHRPHQEEGQDARGGAGTQVLRAVPQRLPGAPGHGRGPGPRHGLHLRPGRFPRHALPGVRAPGAAPRTRGRPPRGRRASVRGLRATAAAVPRAGPGGPDPRHPRGPGRAQPRGAAEPPARRAALRVSGRTGRAARAELRDGRERGRQDVRGLGAQQEAGPGSGRAGRTAGAVRHPDARPRARQGQEDANAA,TSSAEVKENRNVGNLAARPPPSGDRARGGAPGAKRKRPLEEGNGGHLCKLQLVWKKLSWSVAPKNALVQLHELRPGLQYRTVSQTGPVHAPVFAVAVEVNGLTFEGTGPTKKKAKMRAAELALRSFVQFPNACQAHLAMGGGPGPGTDFTSDQADFPDTLFQEFEPPAPRPGLAGGRPGDAALLSAAYGRRRLLCRALDLVGPTPATPAAPGERNPVVLLNRLRAGLRYVCLAEPAERRARSFVMAVSVDGRTFEGSGRSKKLARGQAAQAALQELFDIQMPGHAPGRARRTPMPQ

Amino Acids from 3' Exons

VPAARRRRTATWATWPRGHRPPGTGPGAARPARRGSGRWRRGMGATCANCSWSGRSCRGRWRPRTRWCSCTSGRACSTGQCRRRARCMPRSSRRWRTGSRSRAQAPPRRRPRCARRSWHSGPSCSSPTPARRTWPWAGARAPARTSPPTRPISPTRSSRSSSPRRRAPDSREAAPGTPRFCPRPTGDGGCCAARWTWWARPPPPPRPRASATPWCCTACAPGCATCVWQNRPSGARGASWPAWTAGRSRARGAARSWPGVRPRRPHCRSCSTSRCPATRPAGPGGRQCR,YQQRGGEGEPQRGQPGRAATALRGPGPGRRARREEEAAAGGGEWGPLVQTAAGLEEAVVVGGAQERAGAAARAEAGPAVPDSVADGPGACPGLRGSGGGERAHVRGHRPHQEEGQDARGGAGTQVLRAVPQRLPGAPGHGRGPGPRHGLHLRPGRFPRHALPGVRAPGAAPRTRGRPPRGRRASVRGLRATAAAVPRAGPGGPDPRHPRGPGRAQPRGAAEPPARRAALRVSGRTGRAARAELRDGRERGRQDVRGLGAQQEAGPGSGRAGRTAGAVRHPDARPRARQGQEDANAA,TSSAEVKENRNVGNLAARPPPSGDRARGGAPGAKRKRPLEEGNGGHLCKLQLVWKKLSWSVAPKNALVQLHELRPGLQYRTVSQTGPVHAPVFAVAVEVNGLTFEGTGPTKKKAKMRAAELALRSFVQFPNACQAHLAMGGGPGPGTDFTSDQADFPDTLFQEFEPPAPRPGLAGGRPGDAALLSAAYGRRRLLCRALDLVGPTPATPAAPGERNPVVLLNRLRAGLRYVCLAEPAERRARSFVMAVSVDGRTFEGSGRSKKLARGQAAQAALQELFDIQMPGHAPGRARRTPMPQ