McDonnell Genome Institute

Washington University

CircRNA

chr10|132351606|132365550|+|LRRC27|ENST00000368612.3

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9949

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

7

Peptide

AAEDLEIK

Amino Acids from 5' Exons

KEDSLLQEHLTRPLVTVPNGDPSKKTGREPSGGAPRAPGEAGSDGAAET,RKTASSRSILPDLLSPYQMAIRAKRLEESRAAALRELQEKQALMEQQR,GRQPPPGASYPTSCHRTKWRSEQKDWKRAERRRSESSRRSRLWSSRD

Amino Acids from 3' Exons

CPAGEKFRREDKTARPPNAAKKIPWPGPTGGDEEGCRGSGN,ALQERNLEEKIKQHVLQMREQRRFHGQAPLEEMRKAAEDLEI,PCRREIKRRNSTSSKCVSKEDSMARPHWRRGRLPRIWK