McDonnell Genome Institute

Washington University

CircRNA

chr10|127439026|127444279|+|DOCK1|ENST00000280333.9

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9949

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

KGTANIK

Amino Acids from 5' Exons

VCPGASPAKENALQVPGQAGQGPGEGEEGQEEGKKEQQTSRDIERITHRHFPAAVGCDPFGN,FALEPLLPKKMHSRSQDKLDKDDLEKEKKDKKKEKRNSKHQEIFEKEFKPTDISLQQSEAVILSET,LPWSLSCQRKCTPGPRTSWTRMTWRRRRRTRRRKKGTANIKRYLRKNLNPPTFPCSSLRLSFRK

Amino Acids from 3' Exons

ISPLRPQRPKSQVMNVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSFSMQS,VPCGPRDRRARTSLEAKGASRCPPRHRPPSKHPLQLHQGPSSASACSR,KSPAAPETEEPGDERHWKRKALLGVPLVTVLPANTPSSYTKGQAQLQHAV