McDonnell Genome Institute

Washington University

CircRNA

chr10|127403054|127426011|+|DOCK1|ENST00000280333.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9928

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

IMMWEEAIALGK

Amino Acids from 5' Exons

MWEEAIALGKELAEQYENEMFDYEQLSELL,CGRRPLPWARSPSSMRTKCLIMSNSANC,VGGGHCLGQGASRAVERNVLATQRIA

Amino Acids from 3' Exons

IPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVEKEYGVRIM,FLFWPKGSESMETKSRRHGRSTRGWRPVSNSRKRWRKSTASES,SFSGRRDQNPWRQSHGGTEAVPREDGGLFQTAEGKGGERVRRPNH