McDonnell Genome Institute

Washington University

CircRNA

chr10|127031649|127110354|+|DOCK1|ENST00000280333.9

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9786

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

16

Peptide

LYCLIEIVHSDLFTQHAK

Amino Acids from 5' Exons

LRINLRKYLHHLSSDTMVPPCETESTILSSI,GIENICTSICQADEIRWYHPARRRARSYRL,KDKSEKIFALAFVKLMRYDGTTLRDGEHDLIVYK

Amino Acids from 3' Exons

QNVYIHPQCSHGLADHPETLLLDRNRPQPLHTA,KMFTEFILNVPMGLLTIQKLYCLIEIVHSDLFTQH,KCLLNSSSMFPWACPSRNSTASKSSTVTSSHSM