McDonnell Genome Institute

Washington University

CircRNA

chr10|126970701|127012374|+|DOCK1|ENST00000623213.1

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9386

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

HKPLNMSSR

Amino Acids from 5' Exons

LFITMMPEERMNFLYRSETLCTSKHMK,FLLCQRSGTFFTDRRHCAHLRNI,FYNYDARGADELSLQIGDTVHILETYE

Amino Acids from 3' Exons

ARVGRRHSTQAAEHVIPFFTQGGRGELPSDCYKQSHRCQRSQPQGA,LALDDAIRHKPLNMSSRFSPRVAGENDFLQTVINKVIAAKEVNHKGQ,SRWTTPFDTSRTCHPVFHPGWQGRMTSFRLLTKSSLPKKSTTRGR