McDonnell Genome Institute

Washington University

CircRNA

chr10|125833771|125833946|+|BCCIP|ENST00000278100.10

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9374

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

15

Peptide

AALMFANAEEEFFYEER

Amino Acids from 5' Exons

ERTGGGTQNQAMWEVLLLPSDDICGSRKKQFQKETQQKESCVNVCKCRGRIFL,KELAGAHRTNKPCGKCYFYLLISKTFVEAGKNNSKKKPSNKKKAALMFANAEEEFFYE,KNWRGHTEPISHVGSATFTFLVRHLWKQEKTIPKRNLATKRKLRCLQMQRKNFSM

Amino Acids from 3' Exons

ERTGGGTQNQAMWEVLLLPSDDICGSRKKQFQKETQQKESCVNVCKCRGRIFL,KELAGAHRTNKPCGKCYFYLLISKTFVEAGKNNSKKKPSNKKKAALMFANAEEEFFYE,KNWRGHTEPISHVGSATFTFLVRHLWKQEKTIPKRNLATKRKLRCLQMQRKNFSM