McDonnell Genome Institute

Washington University

CircRNA

chr10|124765391|124774782|-|RP11-12J10.3|ENST00000494792.1

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.969

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

EELLNEFSEGK

Amino Acids from 5' Exons

VEDFLNLSTQLSGFHICIDKGTFDAISLNPDNAIEKRKQYVKSLSRVLKVKGFFLITSCNWTKEELLNEFSE,KTFISPHSCLDFIFVLTKGLLMPALILTMQLRRGSNMNLSPGCKKAFFRHVIGPRKSCMNSVK,RRLFESLHTAVWISYLYQRDFCHKPSQCNEEEAICEISLQGVESKRLFSNNVMLDQGRVAKIQ

Amino Acids from 3' Exons

AKFGFSNITGIDYSPSAIQLSGSIIEKEGLSNIKLK,QNLVSLILLELITLLLQFSFLEVLKKKVYLTLS,KIWFLYYWNLLSFCNSAFWKYYRKRRFIHVK