McDonnell Genome Institute

Washington University

CircRNA

chr10|123154917|123155727|+|BUB3|ENST00000368858.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9234

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

LIKMTGSNEFK

Amino Acids from 5' Exons

MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFY,PVLTSSSTSHPRMASPPSSAPTPPSSCLSPPGTRPCVSTMCRPTPCGSSTSTPAPSWTAPS,DRFRVQAEPATRGWHLLREVQPQHLPVPACLLLGHVRASLRCAGQLHAAQVPAHRRRPGLRLL

Amino Acids from 3' Exons

DPTHAWSGGLDHQLKMHDLNTDQ,IQRMPGVEDIINKCMITLIK,SNACLEWRTRSSIENAFEHS