McDonnell Genome Institute

Washington University

CircRNA

chr10|123041208|123047298|+|ACADSB|ENST00000358776.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9189

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

5

Peptide

LFDFQVGSFCLSEAGAGSDSFALK

Amino Acids from 5' Exons

VGSFCLSEAGAGSDSFALKTRADKEGDYYVLNGSKMWISSAEHAGLFLVMANVDPTI,EVSAFQRLEQVVTHLLRPELIKREIIMSSMDQRCGSAVLSTQGSFWWQMTLP,RKFLPFRGWSRLICFEDQSRGRLLCPQWIKDVDQQCARRALSGDGKCRPYH

Amino Acids from 3' Exons

MLGLAQGCFDYTIPYIKERIQFGKRLFDFQ,CWDWRKDVLTTLFHILKKGYNLAKDYLIF,AGTGARMFLHYSIYRKDTIWQKTIFS