McDonnell Genome Institute

Washington University

CircRNA

chr10|122082646|122088591|+|TACC2|ENST00000334433.7

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9957

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

EADHLVTALEER

Amino Acids from 5' Exons

HWQRWAWRLLHRFEFCQPGSMPCVPRGDAKEGPTGSQGARRFFAAQPTTVPGARAPLVLHALCRVSPGRLLGKSSSGTRWSSDSVSQEGTCPKCPRRHRGGISREGQLYSIPRDCCRPQCWKRETAEGRRTEVLLLLLQWHRPVTWNVASTPQRANEGTAVWRGGPAWWFVPRERGCRWLSPCRVQAGGGFCASDPGPCCSPAGHRKLSGLGEVPPKTHGPDPTRSSPKSLRQRKRPRGGAASVFNRLGIPQGLPSPEQFRGCPRSRSECRFPGELPAASGSISAARRAALGLAKSCPGARGWGLWEGGSGHHCSGSPTDRDARNQAQSSCLCGSRRPARRGFACEPTFPAHSDGSTSSFKPRFIPSCSDSYCCRRTWIIIQGISFQGWDASFCRCSQRGGGCRVGGTGEAGVRSWKQGRASRRGPWRGSCPITPGEGRALEHGAKPGPTRSTTPSSSQGAKPGPTRSTTPSSSQGTKKCQRATGANGWSQGPRFHKPSRGRRKQITWQPWRKGGSPRATWWRPREPARRGLSGFQQQASRSRQRAFKAKQCREQRPSQLTLSTATQKGGCWAHGRAPLSDSRGCIWPTTQAGGGPRPAPCARWSWAHCSRRSHLGGVRIAAQMSHPSEQGRIGKNGVFPDFRIREIRFSTNSCCRGCTQSPGREHIGNKEDGQLWGGLADVPRSTPRAGVCVETGISCWGATSPPGGELGSRPGAHGTHPGPRSAGNPILPRGRLDKRSCIRVAPTIFEASPAIPGTTRDIHLRAQGAGPATKWERDFSKPSRFGPGSRFFPNPCTCGTSGRQLAHSWRTGAGFGIRTSKSAPQRHPVYSNFISHHGLGEFSDRRVRIVSTNETEVACTRGEAARGSMRWSVLEGLASSSRCLKRLFSCRELQQKGNLLHWAGAKQVSTGIGCLGRRQPARSMSKASRSFSSWLFPTLGLEEGDGKWKHRGGPTLSALSSSPGCSSLPASPGARQPRSHTHPGCPRDRGMNPGRQAATSAGPAAENGVLGHFGCRVPKASCKFPISWGARWSRGCDWWQRWCRRPRKAAGSGETWRSYFELWPPSDALPYLRGGSFYLCPTVLPSAPHGQLPGCLAASQRAGWDSQEHHGFFYTPGCPRPKGAPAVWATRSGCSHPLPACRQCCPERSRRQWSESCFLCRPQSSWRKPLSCRGAPTCLGKCCLLEAVCWLPRPPVATRSCRWGNPCSASQQWSQSQNHGTSGLHAMPGPDATSGQGQAGNRGRESSNSSRCRCQGQWGGHGRCSRRDRGQHGEDGRAFPGPKAGHIRWCGHKLANRHPHWLPRLQGAHRQDLREACARSPGHTWRKGRSWEECSGRPHQAIGPREASRWASRSGCHPSPCTSCSTPGGEEATVGWRGDFPSGSARSSFRQASGSSRADLGAELARCRCGEGDGRCPTHTEGRREARGAWGSLARPGRPGLLTAGEEQAGISFRSSFTSSYSGAPCGESCCLPGGSPPWRRGRGPRQNSFWKAAPGNICLRQSTWRRWSRGLCSHRGSRTCAKVHVCPFSSEGGFDCAGQQALDPHAWGKETRSHCWHLGNAKCPGQPEHPCTTNWRSGRHSPGAWQGGRRCWGSRGHHPEHSDTGMCVRSASRYYEDILRCGRLGAARKLSGPSLLQGSGDGGYSCPSWGQPSQAPAGGAARAAPHSSWGWEGVRLLTSRARNSRPEAATFGSRRAPHQ,IGSVGLGGFCTASESSASLDPCLVSPEVTEPRKDPQGARGPEGSLLPSPPPSQEREHPSSSMPFAECPPEGCLASPAAAPEDGPQTQSPRREPAPNAPGDIAAAFPAERDSSTPYQEIAAVPSAGRERQPKEEGQKSSFSFSSGIDQSPGMSPVPLREPMKAPLCGEGDQPGGFESQEKEAAGGFPPAESRQGVASVQVTPEAPAAAQQGTESSAVLEKSPLKPMAPIPQDPAPRASDRERGQGEAPPQYLTDDLEFLRACHLPRSNSGAAPEAEVNAASQESCQQPVGAYLPHAELPWGLPSPALVPEAGGSGKEALDTIDVQGHPQTGMRGTKPNQVVCVAAGGQPEGGLPVSPEPSLLTPTEEAHPASSLASFPAAQIPIAVEEPGSSSRESVSKAGMPVSADAAKEVVDAGLVGLERQVSDLGSKGEHPEGDPGEVPAPSPQERGEHLNTEQSHEVQPGVPPPPLPKEQSHEVQPGAPPPPLPKAPSESARGPPGPTDGAKVHEDSTSPAVAKEGSRSPGDSPGGKEEAPEPPDGGDPGNLQGEDSQAFSSKRDPEVGKDELSKPSSDAESRDHPSSHSAQPPRKGGAGHTDGPHSQTAEADASGLPHKLGEEDPVLPPVPDGAGEPTVPEGAIWEGSGLQPKCPDTLQSREGLGRMESFLTLESEKSDFPPTPVAEVAPKAQEGESTLEIRKMGSCDGEGLLTSPDQPRGPACDASRQEFHAGVPHPPQGENLAADLGLTALILDQDQQGIPSCPGEGWIRGAASEWPLLSSEKHLQPSQAQPETSIFDVLKEQAQPPENGKETSPSHPGFKDQGADSSQIHVPVEPQEDNNLPTHGGQEQALGSELQSQLPKGTLSDTPTSSPTDMVWESSLTEESELSAPTRQKLPALGEKRPEGACGDGQSSRVSPPAADVLKDFSLAGNFSRKETCCTGQGPNKSQQALADALEEGSQHEEACQRHPGASEAADGCSPLWGLSKREMASGNTGEAPPCQPDSVALLDAVPCLPALAPASPGVTPTQDAPETEACDETQEGRQQPVPAPQQKMECWATSDAESPKLLASFPSAGEQGGEAGAAETGGSAGAGDPGKQQAPEKPGEATLSCGLLQTEHCLTSGEEASTSALRESCQAEHPMASCQDALLPARELGGIPRSTMDFSTHQAVPDPKELLLSGPPEVAAPDTPYLHVDSAAQRGAEDSGVKAVSSADPRAPGESPCPVGEPPLALENAASLKLFAGSLAPLLQPGAAGGEIPAVQASSGSPKARTTEGPVDSMPCLDRMPLLAKGKQATGEEKAATAPGAGAKASGEGMAGDAAGETEGSMERMGEPSQDPKQGTSGGVDTSSEQIATLTGFPDFREHIAKIFEKPVLGALATPGEKAGAGRSAVGKDLTRPLGPEKLLDGPPGVDVTLLPAPPARLQVEKKQQLAGEAEISHLALQDPASDKLLGPAGLTWERNLPGAGVGKEMAGVPPTLREDERPEGPGAAWPGLEGQAYSQLERSRQELASGLPSPAATQELPVERAAAFQVAPHSHGEEAVAQDRIPSGKQHQETSACDSPHGEDGPGDFAHTGVPGHVPRSTCAPSPQREVLTVPEANSEPWTLDTLGGERRPGVTAGILEMRNALGNQSTPAPPTGEVADTPLEPGKVAGAAGEAEGDITLSTAETQACASGDLPEAGTTRTFSVVAGDLVLPGSCQDPACSDKAPGMEGTAALHGDSPARPQQAKEQPGPERPIPAGDGKVCVSSPPEPDETHDPKLQHLAPEELHTD,LAALGLEASAPLLRVLPAWIHALCPQRLSQGRTHREPGGQKVLCCPAHHRPRSESTPRPPCPLPSVPRKVAWQVQQRHLKMVLRLSLPGGNLPQMPQETSRRHFPLRGTALLHTKRLLPSPVLEERDSRRKKDRSPPSPSPVASTSHLECRQYPSESQRHRCVERGTSLVVLSPKRKRLQVAFPLQSPGRGWLLCKPLRPLLQPSRAQKAQRSWRSPPNPWPRSHKIQPQEPQTEKEAKGRRRLSIQMTWNSSGPAISLGAIQGLPQKQKMPLPRRAASSQWEHICRTQSCPGACQVLPWCQRLGALGRRLWTPLMFRVTHRQGCEEPSPIKLSVWQQAASPKGVCLALNLPCSLRLRKHIQLQASLHSQLLRFLLLKNLDHHPGNQFPRLGCQFLQMQPKRWWMQGWWDWRGRCQILEARESIQKGTLERFLPHHPRRGESTTRSKAMRSNQEYHPLLFPRSKAMRSNQEHHPLLFPRHQVKVPEGHRGQRMEPRSMKIPQAQPWLKKEADHLVTALEERRKPQSHLMVETQGTCKERTLRLSAASVIQKAKMSFQSQAVMQRAETIPAHTQHSHPERGVLGTRTGPTLRQQRLMHLAYHTSWVRRTPSCPLCQMELVSPLFPKEPSGRGQDCSPNVLTPFRAGKDWEEWSLSLNQRNQIFHQLLLQRLHPKPRKVRAHWKGRWAAVMGRACRPQINPAGRRVMRRDRNFMLGCHIPPRGRTWQQTWGSRHSSWTKISRESHPAQGKAGEELHPSGPYYLLRSISSHPRHNQRHPSLTCSRSRPSHLKMGKRLLQAIQVLRTREQILPKSMYLWNLRKITTCPLMEDRSRLWDQNFKVSSPKAPCLILQLHLPLTWFGRVLQKSQNCQHQRDRSCLHGRSGQREHAVMVSPRGSRLQQQMSKTFLLQGTSAERKLAALGRGQTSLNRHWLMPWKKAASMKKHVKGIQELLKQLMVVPHSGAVRGRWQVETQGRPHLVSLTQLSWMQFPACQPWRPPAPESHPPRMPQRQRHVMKPRKAGSNQCRPRSRKWSAGPLRMQSPQSFLQVSHQLGSKVVKPGLLRLVAALVQETQESSRLRRNLEKLLVVASFRLSTALPPGRKLLPLPYVSPAKLSTPWPAARMPCCQPESWVGFPGAPWIFLHTRLSQTQRSSCCLGHQKWLLLTPLTCMSTVLPREEQKTVEKLFPLQTPELLAKAPVLGSPHLPWKMLPPSCLLAPSPPCCNQELQVGKSLQCKPAVVVPKPEPLRDQWTPCHAWTGCHFWPRASRQQGKRKQQQLQVQVPRPVGRAWQVMQQERQRAAWRGWESLPRTQSRAHQVVWTQALSKSPPSLASQTSGSTSPRSSRSLCSEPWPHLEKRQELGGVQWVKTSPGHWAQRSFMGLQEWMSPFSLHLLLDSRWRRSNSWLERLRFPIWLCKIQLQTSFWVQQGPGSGTCQVPVWGRRWQVSHPHGKTRGQRGLGQPGQAWKARLTHSWRGAGRNLQVFLHQQLLRSSLWRELLPSRWLPIAMEKRPWPKTEFLLESSTRKHLPATVHMEKMVPGTLLTQGFQDMCQGPRVPLLLRGRFLCLRPTVSPGPLTRLGVKGDPESLLASWKCEMPWATRAPLHHQLEKWQTLPWSLARWQALLGKQRVTSPAQLRHRHVRPVICLKQVLRGHSPLWQVTWCCQEAVRTQPALTRLRGWRVQLPFMGTAQPGPSRLRSSQGLSAPFQLGMGRCASPHLQSLTKLTTRSCNIWLQKSSTLT

Amino Acids from 3' Exons

REPQAWPIHVTFGSEGCSKSHGSHFRDQRCGRNRK,ESPRPGPSMLPSVPKKDAPRVMDKVTSDETRGAEGTE,RAPGLAHPCYLRFLRRMLQESWIKSLQMRPEVRKEQK