McDonnell Genome Institute

Washington University

CircRNA

chr10|121902390|121924329|-|ATE1|ENST00000224652.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9995

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

6

Peptide

LEACGHIP

Amino Acids from 5' Exons

AKGLIVSLHVEKQRKSGKKGKGNCSRTQLENLRVSRLKVTHHLCFHQRLNPTSQNHSKIFLSLYQRMHHTS,QRGFEASMSKSKGNPERKEKVKTNAAEPSWRTGFPGSRSPTIFVSTKGIQPAKITRRFNFVFTRECITQVR,KGADLSKPPCRKAKEIRKERKRLKLMQQNPAGELEGFQAQGHPPSLFPPKAKSNQPKSLEDLIFESLPENASHKLE

Amino Acids from 3' Exons

ACGHIPQYRIIRISTEDGE,HVGTFHDSTGLSGSHRPRMAK,MWAHSMTVQDYQDLIDRGWR