McDonnell Genome Institute

Washington University

CircRNA

chr10|121790168|121898969|-|ATE1|ENST00000369040.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

YQVAIHQDPPDECGK

Amino Acids from 5' Exons

GQYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEA,VSIDLLICCALRHMFGYPLSNACLHLKTPSTAVSTRTQKQ,SVTFFAVPDICLGTHAMPAFTKLQVLPFQPGPRS

Amino Acids from 3' Exons

VRLVPVSFEDPEFKSSFSQSFSLYVKYQVAIHQDPPDECGKTE,GYLSPLRTQSSSRLSASPFLCMSSIKWPYTRIHPMNVGRL,EVSTCLLGPRVQVVFQPVLFFVCQVSSGHTPGSTRMWED